Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc08g066500.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_002573 |
| Alias | 8:52418751|52419060 |
| Organism | Solanum lycopersicum |
| Position | chr8: 55209601-55209910 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc08g066500.2 |
| Parent gene annotation |
Homeobox-leucine zipper protein ATHB-8 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc08g066500.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.433056219 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
55209863-55209668(+) 55209843-55209694(-) |
| Potential amino acid sequence |
MLMTHTVDATLQAHSMVAQSLTKCAQRSRSSSPARDSRM*(+) MAALRHLRQISQEISHPTVSGWGRRPAALRALGQRLSNHGVCLKCCVHCMSHQHCCRRGQLWRH YVT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |