Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G22650_circ_g.3 |
ID in PlantcircBase | ath_circ_003924 |
Alias | AT1G22650_C1, AT1G22650_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 8014799-8015684 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G22650 |
Parent gene annotation |
Probable alkaline/neutral invertase D |
Parent gene strand | - |
Alternative splicing | AT1G22650_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G22650.2:2 AT1G22650.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.347799146 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8015649-8015588(-) |
Potential amino acid sequence |
MEGVNSSSSISDLDELARLLDRPRVNIERKRSFDERSFSEMGIFDNVNSPGGWETPVSSARNSF EPHPMVAEAWDALRRSLVYFRGQPVGTIAAYDHATEEVLNYDQVFVRDFVPSALAFLMNGEPDI VKNFLLKTIQIQGREKRIDRFKLGEGAMPASFKVIHDPIKETDSINADFGESAIGRVAPVDSGF WWIILLRAYTKSTGDTSLAETSECQKGMRLILSLCLSEGFDTFPTLLCADGCSMIDRRMIYTHR NTKLKNPHGRSKLFKLYIRPRRIGSVT* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |