Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0644000_circ_g.6 |
ID in PlantcircBase | osa_circ_015770 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 25898371-25898997 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0644100 |
Parent gene annotation |
Similar to Heat shock protein STI (Stress inducible protein) (Gm STI). (Os02t0644100-01);Similar to heat shock protein STI. (Os02 t0644100-02) |
Parent gene strand | + |
Alternative splicing | Os02g0644000_circ_g.3 Os02g0644000_circ_g.4 Os02g0644000_circ_g.5 Os02g0644000_circ_g.7 Os02g0644000_circ_g.8 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | NA:0 Os02t0644100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.387086204 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25898817-25898371(+) 25898419-25898909(-) |
Potential amino acid sequence |
MPEGLKDAEKCIELDPTFSKGYTRKGAIQFFMKEYDKAMETYQAGLKHDPNNPELLDGVKR*(+ ) MLYRVWIFLLLEKLITFSHRPAVPGYSDHASNRPGKFPLPCHILS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |