Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0644000_circ_g.6 |
| ID in PlantcircBase | osa_circ_015770 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 25898371-25898997 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0644100 |
| Parent gene annotation |
Similar to Heat shock protein STI (Stress inducible protein) (Gm STI). (Os02t0644100-01);Similar to heat shock protein STI. (Os02 t0644100-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0644000_circ_g.3 Os02g0644000_circ_g.4 Os02g0644000_circ_g.5 Os02g0644000_circ_g.7 Os02g0644000_circ_g.8 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | NA:0 Os02t0644100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.387086204 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25898817-25898371(+) 25898419-25898909(-) |
| Potential amino acid sequence |
MPEGLKDAEKCIELDPTFSKGYTRKGAIQFFMKEYDKAMETYQAGLKHDPNNPELLDGVKR*(+ ) MLYRVWIFLLLEKLITFSHRPAVPGYSDHASNRPGKFPLPCHILS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |