Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0895100_circ_g.7 |
| ID in PlantcircBase | osa_circ_005195 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 38913610-38914053 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0895100 |
| Parent gene annotation |
Similar to Membrane-associated 30 kDa protein, chloroplast precu rsor (M30). (Os01t0895100-01);Similar to Membrane-associated 30 kDa protein, chloroplast precursor (M30). (Os01t0895100-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0895100_circ_g.4 Os01g0895100_circ_g.5 Os01g0895100_circ_g.6 Os01g0895100_circ_g.8 Os01g0895100_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0895100-01:2 Os01t0895100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.175488438 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38914027-38914002(+) 38913986-38914034(-) |
| Potential amino acid sequence |
MNLRLHLHRTIIRSLFSGFVFVLKPLLRSQDLCSGLPHLCQIVIHFQNSLV*(+) MNDDLTKMRQATAQVLASQKRLENKYKAAEQASDDCPMQMQS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |