Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0665500_circ_g.3 |
| ID in PlantcircBase | osa_circ_025833 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 33970837-33971973 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0665500 |
| Parent gene annotation |
Similar to H1005F08.9 protein. (Os04t0665500-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0665500_circ_g.2 |
| Support reads | 6 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0665500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140148776 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33971839-33970871(+) 33970988-33971934(-) |
| Potential amino acid sequence |
MLLLDQYYVTQNFRSCSAARAFLVLDYQSCLLTTSLRKHSISSLTDCQAALAIYSAE*(+) MFRQQFIHLKHVSCVSSKNHTKFIIADYLPFVIRILKIILPNILPKLLDNQLMRICYVSLMKW* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |