Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | scaffold110.118_circ_g.1 |
| ID in PlantcircBase | ecr_circ_000051 |
| Alias | NA |
| Organism | Echinochloa crus-galli |
| Position | chrscaffold110: 1897179-1897344 JBrowse» |
| Reference genome | Echinochloa crus-galli v2 |
| Type | e-circRNA |
| Identification method | circseq-cup |
| Parent gene | scaffold110.118 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | No-No |
| Splicing signals | TC-TC |
| Number of exons covered | scaffold110.118:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_013331 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1897339-1897263(-) |
| Potential amino acid sequence |
MINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSRADDQRPEQEL VLLCGVDPQQRQVQRV* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | NA |