Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0408200_circ_g.4 |
| ID in PlantcircBase | osa_circ_027861 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 19926154-19926783 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0408200 |
| Parent gene annotation |
SBP domain containing protein. (Os05t0408200-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0408200_circ_g.3 Os05g0408200_circ_g.5 Os05g0408200_circ_g.6 Os05g0408200_circ_g.7 Os05g0408200_circ_g.8 Os05g0408200_circ_g.9 Os05g0408200_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0408200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.246272963 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19926698-19926159(+) 19926162-19926694(-) |
| Potential amino acid sequence |
MPVELEGYIRPGCTILTVFVAMPQHMWDKRT*(+) MFSCPTYVVALQQIQLKLYNQDEYSPPVQQAC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |