Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0596600_circ_g.11 |
| ID in PlantcircBase | osa_circ_029257 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29738008-29740101 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0596600 |
| Parent gene annotation |
Similar to SMC5 protein. (Os05t0596600-01);Similar to SMC5 prote in. (Os05t0596600-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0596600_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0596600-01:4 Os05t0596600-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112219341 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29738047-29740073(-) 29739354-29740035(-) |
| Potential amino acid sequence |
MIYNHMKHLKLKWHHCPQKGSH*(-) MKKKLPWLKYDMKKKEYKEAQEKEKTEKKKMEEVAKIWEDSKGPVEELKKKKMSHTSNTKRINS HMAENMKRRQDITHKELQLKGQLRATLEDIEDLKRQERSRQQRILKAKEALAAAERELDDLQPY EAPKAEMAPLSPKRKSLISSRNSIFKSTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |