Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0556101_circ_g.1 |
| ID in PlantcircBase | osa_circ_031135 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 21190473-21190690 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0556101 |
| Parent gene annotation |
Hypothetical protein. (Os06t0556101-00) |
| Parent gene strand | - |
| Alternative splicing | Os06g0556000_circ_g.1 |
| Support reads | 23 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0556000-01:1 Os06t0556101-00:1 Os06t0556000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23479159 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21190609-21190546(+) 21190547-21190546(+) |
| Potential amino acid sequence |
MAFHPRRGHVILILDHCRWPLACANNIRAVHKANCYHKNGHDADCGVYDTTYMIVFGVVQIFFS MLPNFSDLSWLSILAAVMSFSYSTIAVGLSLARTISGLCTRPTATTRTATMPIAVSTTPRT*(+ ) MIVFGVVQIFFSMLPNFSDLSWLSILAAVMSFSYSTIAVGLSLARTISGLCTRPTATTRTATMP IAVSTTPRT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |