Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d018462_circ_g.1 |
ID in PlantcircBase | zma_circ_008843 |
Alias | zma_circ_0002022 |
Organism | Zea mays |
Position | chr5: 221222981-221224449 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d018462 |
Parent gene annotation |
Phospholipid--sterol O-acyltransferase |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d018462_T004:5 Zm00001d018462_T001:5 Zm00001d018462_T007:5 Zm00001d018462_T002:5 Zm00001d018462_T003:5 Zm00001d018462_T009:4 Zm00001d018462_T006:4 Zm00001d018462_T008:4 Zm00001d018462_T005:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.06029878 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
221223118-221224426(-) 221223039-221224437(-) |
Potential amino acid sequence |
MNIDHHHGDDILPNMTRVPHVKYITYYEDAESLPGWRTAVWELDKGIIRVIQF*(-) MRMLKVFQDGEQQSGSSIKVLSG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |