Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0281600_circ_g.6 |
| ID in PlantcircBase | osa_circ_038715 |
| Alias | Os_ciR12002 |
| Organism | Oryza sativa |
| Position | chr9: 6018182-6018516 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0281600 |
| Parent gene annotation |
Similar to Gamma response I protein. (Os09t0281600-01);Similar t o Gamma reponse I-like protein. (Os09t0281600-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0281600_circ_g.5 Os09g0281600_circ_g.7 |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0281600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.311396866 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6018247-6018190(+) 6018221-6018190(+) 6018281-6018506(-) |
| Potential amino acid sequence |
MLLAQSKEAQASKHASSSTPSSRAPSAPQRSSFEQKTNYQTPASALYGAYEGSSSQGSSSGYGF CLIRTVQTTNTMSFGLLKKKCYLLSQRRPRHQNMLAQALQAPEHQVPHREAHLNKRLIIKHLLQ LCMGHMRVVLPKEAHLAMVSV*(+) MSFGLLKKKCYLLSQRRPRHQNMLAQALQAPEHQVPHREAHLNKRLIIKHLLQLCMGHMRVVLP KEAHLAMVSV*(+) MPGPPLTEQVTFLLQQAETHSICSLNSSYQTETIAR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |