Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA025135_circ_g.2 |
ID in PlantcircBase | osi_circ_007017 |
Alias | 7:2220728|2221465 |
Organism | Oryza sativa ssp. indica |
Position | chr7: 2220728-2221465 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA025135 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA025135_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA025135-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_032748* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2220750-2221198(-) 2221447-2220821(+) 2220758-2220757(+) |
Potential amino acid sequence |
MHPEGVSLGWVLPIAFSNLLDPVHEWLKLGEELRGICVCSRTGRRFFWSVFS*(-) MGRTQPRETPSGCICADEEKRSSTCCKPSELQPNIQDS*(+) MKKRGVPLAANQVNYSLIYRTPELNGVKAACDELGITLIAYSPIAQGVLSGKYTPEKPPTGPRA NTYTPEFLTKLQPLMNRIKEIGESYGKNPTQRNAFGMHMRG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |