Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0123100_circ_g.2 |
ID in PlantcircBase | osa_circ_026374 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 1283339-1283624 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup |
Parent gene | Os05g0123100 |
Parent gene annotation |
Glycosyl transferase, family 43 protein. (Os05t0123100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/4 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0123100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015253 |
PMCS | 0.427173893 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1283368-1283413(+) 1283354-1283530(-) |
Potential amino acid sequence |
MSAGEKKVVVEGPLCSDSKVVGWFSRDFNDGTTRAVTYNTEADLNPAGAAGTRAHTIDVSGFAF NSSILWDPERWGRPTSLPDTSQGIWHMASGNNVGRREESGSRGPAMQ*(+) MCQMPCEVSGNDVGLPQRSGSHKIELLNANPETSIV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2016;Chu et al., 2017 |