Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0123100_circ_g.2 |
| ID in PlantcircBase | osa_circ_026374 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 1283339-1283624 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os05g0123100 |
| Parent gene annotation |
Glycosyl transferase, family 43 protein. (Os05t0123100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/4 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0123100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015253 |
| PMCS | 0.427173893 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1283368-1283413(+) 1283354-1283530(-) |
| Potential amino acid sequence |
MSAGEKKVVVEGPLCSDSKVVGWFSRDFNDGTTRAVTYNTEADLNPAGAAGTRAHTIDVSGFAF NSSILWDPERWGRPTSLPDTSQGIWHMASGNNVGRREESGSRGPAMQ*(+) MCQMPCEVSGNDVGLPQRSGSHKIELLNANPETSIV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |