Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0432300_circ_g.5 |
| ID in PlantcircBase | osa_circ_006878 |
| Alias | Os_ciR2359 |
| Organism | Oryza sativa |
| Position | chr10: 15426001-15426347 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os10g0432300 |
| Parent gene annotation |
Similar to Transcription factor IID, TFIID (Fragment). (Os10t043 2300-01);Non-protein coding transcript. (Os10t0432300-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0432300_circ_g.1 Os10g0432300_circ_g.2 Os10g0432300_circ_g.3 Os10g0432300_circ_g.4 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0432300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.219939049 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15426105-15426018(+) 15426107-15426281(-) |
| Potential amino acid sequence |
MITAAKRFGLYSALRACRAIFFRSNLQSRFTVETMFLPRSKL*(+) MRIRDPKTTALIFASGKMVCTGAKSEDHSKLAARKEHCFDSKSGLQVGSEKNRSTGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |