Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0432300_circ_g.5 |
ID in PlantcircBase | osa_circ_006878 |
Alias | Os_ciR2359 |
Organism | Oryza sativa |
Position | chr10: 15426001-15426347 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os10g0432300 |
Parent gene annotation |
Similar to Transcription factor IID, TFIID (Fragment). (Os10t043 2300-01);Non-protein coding transcript. (Os10t0432300-02) |
Parent gene strand | - |
Alternative splicing | Os10g0432300_circ_g.1 Os10g0432300_circ_g.2 Os10g0432300_circ_g.3 Os10g0432300_circ_g.4 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0432300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.219939049 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15426105-15426018(+) 15426107-15426281(-) |
Potential amino acid sequence |
MITAAKRFGLYSALRACRAIFFRSNLQSRFTVETMFLPRSKL*(+) MRIRDPKTTALIFASGKMVCTGAKSEDHSKLAARKEHCFDSKSGLQVGSEKNRSTGS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |