Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0483200_circ_g.4 |
| ID in PlantcircBase | osa_circ_037404 |
| Alias | Os08circ11640/Os_ciR1303 |
| Organism | Oryza sativa |
| Position | chr8: 23873917-23875208 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
| Parent gene | Os08g0483200 |
| Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os08t0483200-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0483200_circ_g.2 Os08g0483200_circ_g.3 |
| Support reads | 4/17/4 |
| Tissues | leaf and panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0483200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007814* osi_circ_018001 |
| PMCS | 0.475819935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23874433-23873950(+) 23873951-23873987(-) |
| Potential amino acid sequence |
MGADGTTYCFFLDLVKSTLIVLSFRVVEFRWLSAERASSSEPMVTNANPLFLVELYIESGKMSV KQSSII*(+) MIEDCLTDIFPLSMYNSTRNRGLAFVTMGSEEEALSALNHLNSTTLNDRTIKVDFTRSRKKQYV VPSAPMPKHSVFVGNLTWRVRSRHLRELFASTPGVQSVEVVFHTTSPRRSAGYGFVSFSSKEAA EAAISTFNGTKLMGRSINVMFKDDNAKKNKSAAPTEEDLKAESSEQIVS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |