Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0483200_circ_g.4 |
ID in PlantcircBase | osa_circ_037404 |
Alias | Os08circ11640/Os_ciR1303 |
Organism | Oryza sativa |
Position | chr8: 23873917-23875208 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
Parent gene | Os08g0483200 |
Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os08t0483200-01) |
Parent gene strand | - |
Alternative splicing | Os08g0483200_circ_g.2 Os08g0483200_circ_g.3 |
Support reads | 4/17/4 |
Tissues | leaf and panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0483200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007814* osi_circ_018001 |
PMCS | 0.475819935 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23874433-23873950(+) 23873951-23873987(-) |
Potential amino acid sequence |
MGADGTTYCFFLDLVKSTLIVLSFRVVEFRWLSAERASSSEPMVTNANPLFLVELYIESGKMSV KQSSII*(+) MIEDCLTDIFPLSMYNSTRNRGLAFVTMGSEEEALSALNHLNSTTLNDRTIKVDFTRSRKKQYV VPSAPMPKHSVFVGNLTWRVRSRHLRELFASTPGVQSVEVVFHTTSPRRSAGYGFVSFSSKEAA EAAISTFNGTKLMGRSINVMFKDDNAKKNKSAAPTEEDLKAESSEQIVS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |