Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0394700_circ_g.3 |
ID in PlantcircBase | osa_circ_023649 |
Alias | Os_ciR1706 |
Organism | Oryza sativa |
Position | chr4: 19414239-19414446 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0394700 |
Parent gene annotation |
BAR domain containing protein. (Os04t0394700-01) |
Parent gene strand | + |
Alternative splicing | Os04g0394700_circ_g.1 Os04g0394700_circ_g.2 |
Support reads | 14/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0394700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.511017468 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19414256-19414247(+) 19414365-19414445(-) |
Potential amino acid sequence |
MRAAYREKGRSRHSKTETLSSEQLQAYFLDYQEDAALFIFRLKSLKQGQFRSILTQAARHHSAQ TGI*(+) MLHPLDSQENKLAAVPRIMFRFWNALTVLSLYRLLAWLHIPV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |