Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G10310_circ_g.6 |
| ID in PlantcircBase | ath_circ_020817 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3191649-3192009 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G10310 |
| Parent gene annotation |
P-loop nucleoside triphosphate hydrolases superfamily protein wi th CH (Calponin Homology) domain-containing protein |
| Parent gene strand | + |
| Alternative splicing | AT3G10310_circ_g.1 AT3G10310_circ_g.2 AT3G10310_circ_g.3 AT3G10310_circ_g.4 AT3G10310_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G10310.2:2 AT3G10310.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198352212 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3191712-3192006(+) |
| Potential amino acid sequence |
MPLEELPVHEEDQSSRSLSHKTKCNHKRLLKTQEKELALQSVFKNLLSEGTLKPSDLKSMPLEE LPVHEEDQSSRSLSHKTKCNHKRLLKTQEKELALQSVFKNLLSEGTLKPSDLKSMPLEELPVHE EDQSSRSLSHKTKCNHKRLLKTQEKELALQSVFKNLLSEGTLKPSDLKSMPLEELPVHEEDQSS RSLSHKTKCNHKRLLKTQEKELA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |