Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G01880_circ_g.5 |
| ID in PlantcircBase | ath_circ_000141 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 308148-308573 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT1G01880 |
| Parent gene annotation |
Flap endonuclease GEN-like 1 |
| Parent gene strand | - |
| Alternative splicing | AT1G01880_circ_g.1 AT1G01880_circ_g.2 AT1G01880_circ_g.3 AT1G01880_circ_g.4 |
| Support reads | 2 |
| Tissues | root, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G01880.2:2 AT1G01880.3:2 AT1G01880.4:2 AT1G01880.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.344720605 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
308184-308150(-) |
| Potential amino acid sequence |
MCVIKDIKPNSRFGAYPVFVVDGTPSPLKSQARISRFFRSSGIDTCNLPVIKDGVSVERNKLFS EWVRECVELLELLGIPVLKANGEAEALCAQLNSQGFVDACITPDSDAFLFGAMCVIKDIKPNSR FGAYPVFVVDGTPSPLKSQARISRFFRSSGIDTCNLPVIKDGVSVERNKLFSEWVRECVELLEL LGIPVLKANGEAEALCAQLNSQGFVDACITPDSDAFLFGAMCVIKDIKPNSRFGAYPVFVVDGT PSPLKSQARISRFFRSSGIDTCNLPVIKDGVSVERNKLFSEWVRECVELLELLGIPVLKANGEA EALCAQLNSQGFVDACITPDSDAFLFGAMCVIKDIKPNSR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |