Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0827600_circ_g.1 |
ID in PlantcircBase | osa_circ_017335 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35568470-35569814 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0827600 |
Parent gene annotation |
Protein of unknown function DUF3531 domain containing protein. ( Os02t0827600-01) |
Parent gene strand | - |
Alternative splicing | Os02g0827600_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0827600-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.233467608 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35569482-35568485(+) 35569314-35569493(-) |
Potential amino acid sequence |
MNEFSGLKSRKLTLNATIDPVLDLLNCALPFLRTLSWILSLIV*(+) MGRLGAYNSSNLQLANSMLDYDPSYDSDQASGVMPSSFHDISDVEFQDNWGRVWVDLGTSDYLG LDVLLNCLTQLSSESKKGYARKAGHNSTNPRQGLLLHSKSAFETSTH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |