Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0001s44200_circ_g.6 |
ID in PlantcircBase | pop_circ_000482 |
Alias | Chr01:44129269-44129630 |
Organism | Populus trichocarpa |
Position | chr1: 44671130-44671491 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0001s44200 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | POPTR_0001s44200_circ_g.1 POPTR_0001s44200_circ_g.2 POPTR_0001s44200_circ_g.3 POPTR_0001s44200_circ_g.4 POPTR_0001s44200_circ_g.5 |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | POPTR_0001s44200.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145307182 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
44671490-44671134(+) 44671150-44671441(-) |
Potential amino acid sequence |
MVSDLSAFEAKTEFEEQKKLICELQNRLEDAELKIVEGETLRKKLHNTILELKGNIRVFCRVRP LLPEDSPGADGKDVSYPTTTEALGRGIDLTQNGI*(+) MQINQIPFCVRSMPRPRASVVVG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |