Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G08510_circ_g.2 |
ID in PlantcircBase | ath_circ_001395 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 2692356-2692469 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G08510 |
Parent gene annotation |
Palmitoyl-acyl carrier protein thioesterase, chloroplastic |
Parent gene strand | - |
Alternative splicing | AT1G08510_circ_g.1 |
Support reads | 10 |
Tissues | aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G08510.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.277182895 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2692418-2692358(-) |
Potential amino acid sequence |
MRRDWLVRDCNTGETLTRASRGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGETLTRASRGDVVE VDTWVSQSGKNGMRRDWLVRDCNTGETLTRASRGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGE TLTRAS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |