Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G34140_circ_g.3 |
| ID in PlantcircBase | ath_circ_034573 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16353076-16353162 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRI-full |
| Parent gene | AT4G34140 |
| Parent gene annotation |
D111/G-patch domain-containing protein |
| Parent gene strand | + |
| Alternative splicing | AT4G34140_circ_g.1 AT4G34140_circ_g.2 AT4G34140_circ_g.4 AT4G34140_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G34140.8:1 AT4G34140.10:1 AT4G34140.5:1 AT4G34140.7:1 AT4G34140.2:1 AT4G34140.4:1 AT4G34140.9:1 AT4G34140.6:1 AT4G34140.3:1 AT4G34140.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.17900267 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16353151-16353159(+) 16353153-16353078(-) |
| Potential amino acid sequence |
MFEEKTKRKAKKVKPKADCKLTVKPCEVDMFEEKTKRKAKKVKPKADCKLTVKPCEVDMFEEKT KRKAKKVKPKADCKLTVKPCEVDMFEE(+) MSTSQGFTVSLQSAFGFTFLALRFVFSSNMSTSQGFTVSLQSAFGFTFLALRFVFSSNMSTSQG FTVSLQSAFGFTFLALRFVFSSNMSTSQGFTVSLQSAFGFTFLALRFV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |