Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0575500_circ_g.2 |
| ID in PlantcircBase | osa_circ_015137 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 22079766-22080613 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0575500 |
| Parent gene annotation |
Similar to ABC transporter-like. (Os02t0575500-01);Similar to AT ATH13. (Os02t0575500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0575500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.307554059 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22080556-22079820(+) 22079772-22079771(+) 22079894-22080581(-) |
| Potential amino acid sequence |
MVPRETGLLSMMSAHLFCIRRDDGGEKGNEEESSCQVA*(+) MTEEKRVMRRKVLAKWLKESILRLGPTFIKIGQQFSTRVDILPQEYVDQLSELQDQVPPFPSET AVSIIEEELGASVNKIFDRFDFEPIAAASLGQVHRACLNGKEVVIKVQRPGLKELFDIDLKNLR VIAEYLQKVDPKSDGAKRDWVAIYDECASVLYQEG*(+) MSTLVENCCPILINVGPSLKILSLSHLARTFLLITLFSSVIPPDTKQMRTHHR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |