Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0222500_circ_g.1 |
| ID in PlantcircBase | osa_circ_000889 |
| Alias | Os_ciR6574 |
| Organism | Oryza sativa |
| Position | chr1: 6701052-6702522 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0222500 |
| Parent gene annotation |
Similar to Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPa se E subunit) (Vacuolar proton pump E subunit). (Os01t0222500-01 ) |
| Parent gene strand | - |
| Alternative splicing | Os01g0222500_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0222500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215919437 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6702126-6702129(-) 6701105-6702487(-) |
| Potential amino acid sequence |
MSMLEAAGKELLYITRDHHVYKNLLRIFIVQSLLRLKEPAVILRCRKEDRELVESVLESAKNEY ADKANIYPPEIMVDRNVYLPPAPSHYEAHGPSWNFKSRNYSWWKLKRRGSGWNLNGTRSKVISR RKLNTQSSSMLPDLKFCKLKMI*(-) MSICLLLPVIMRHMDPPGISNRETTAGGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |