Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0222500_circ_g.1 |
ID in PlantcircBase | osa_circ_000889 |
Alias | Os_ciR6574 |
Organism | Oryza sativa |
Position | chr1: 6701052-6702522 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0222500 |
Parent gene annotation |
Similar to Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPa se E subunit) (Vacuolar proton pump E subunit). (Os01t0222500-01 ) |
Parent gene strand | - |
Alternative splicing | Os01g0222500_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0222500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215919437 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6702126-6702129(-) 6701105-6702487(-) |
Potential amino acid sequence |
MSMLEAAGKELLYITRDHHVYKNLLRIFIVQSLLRLKEPAVILRCRKEDRELVESVLESAKNEY ADKANIYPPEIMVDRNVYLPPAPSHYEAHGPSWNFKSRNYSWWKLKRRGSGWNLNGTRSKVISR RKLNTQSSSMLPDLKFCKLKMI*(-) MSICLLLPVIMRHMDPPGISNRETTAGGS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |