Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G54270_circ_g.1 |
| ID in PlantcircBase | ath_circ_027427 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 20087605-20088001 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT3G54270 |
| Parent gene annotation |
Probable sucrose-phosphatase 3a |
| Parent gene strand | - |
| Alternative splicing | AT3G54270_circ_g.2 |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G54270.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156205395 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20087936-20087607(-) |
| Potential amino acid sequence |
MENLYGDGKEKKFRIWLDNVTSSHISSDTWLAKFVKHELSEGKVRSCSTKVLLSYKSPLGIFVH PSGVEKPIHEWIDEMENLYGDGKEKKFRIWLDNVTSSHISSDTWLAKFVKHELSEGKVRSCSTK VLLSYKSPLGIFVHPSGVEKPIHEWIDEMENLYGDGKEKKFRIWLDNVTSSHISSDTWLAKFVK HELSEGKVRSCSTKVLLSYKSPLGIFVHPSGVEKPIHEWIDEMENLYGDGKEKKFRIWLDNVTS SHISSDTWLAKFVKHELSEGKVRSCSTKVLLSYK(-) |
| Sponge-miRNAs | ath-miR773a |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |