Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0622100_circ_g.2 |
ID in PlantcircBase | osa_circ_015548 |
Alias | Os_ciR7896 |
Organism | Oryza sativa |
Position | chr2: 24768661-24770547 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0622100 |
Parent gene annotation |
Casein kinase I, Low temperature tolerance, Root development, Ho rmone sensitivity (Os02t0622100-01) |
Parent gene strand | + |
Alternative splicing | Os02g0622100_circ_g.1 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0622100-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.16258404 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24768713-24768695(+) |
Potential amino acid sequence |
MLLQGGTGIPHLKWFGVEGEYNVMVIDLLGPSLEDLFNYCNRKFSLKTVLMLADQMINRVEYMH TRGFLHRDIKPDNFLMGLGRKASQVYVIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNT HLGVGICKIKASSASL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |