Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_12G184900_circ_g.2 |
| ID in PlantcircBase | gma_circ_003336 |
| Alias | Gm12circRNA1118 |
| Organism | Glycine max |
| Position | chr12: 34618613-34619365 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_12G184900 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_12G184900_circ_g.1 GLYMA_12G184900_circ_g.3 |
| Support reads | NA |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GC-AG |
| Number of exons covered | KRH26642:2 KRH26641:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.032757747 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34618657-34618656(+) |
| Potential amino acid sequence |
MTDSKEKNRKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIG LDYMDVEALKKLNKNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAVSFRVMLLEKLSQE S*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |