Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G09200_circ_g.3 |
| ID in PlantcircBase | ath_circ_020594 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2824086-2824184 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G09200 |
| Parent gene annotation |
60S acidic ribosomal protein P0-2 |
| Parent gene strand | - |
| Alternative splicing | AT3G09200_circ_g.1 AT3G09200_circ_g.2 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G09200.1:1 AT3G09200.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.292926091 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2824145-2824088(-) 2824097-2824181(+) |
| Potential amino acid sequence |
MWLSNLATLVSTHPKHLSSRLVPLLVWVWWLQLMWLSNLATLVSTHPKHLSSRLVPLLVWVWWL QLMWLSNLATLVSTHPKHLSSRLVPLLVWVWWLQLMWLSNLATLVSTHPKHLSS(-) MFGMGRDQCCQVGQPHQLEPPNPHEQGHQPGRKMFGMGRDQCCQVGQPHQLEPPNPHEQGHQPG RKMFGMGRDQCCQVGQPHQLEPPNPHEQGHQPGRKMFGMGRDQCCQVGQPHQLEPPNPHEQGHQ (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |