Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G35650_circ_g.7 |
ID in PlantcircBase | ath_circ_016673 |
Alias | AT2G35650_C1, AT2G35650_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 14987229-14987939 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT2G35650 |
Parent gene annotation |
Probable mannan synthase 7 |
Parent gene strand | + |
Alternative splicing | AT2G35650_circ_g.2 AT2G35650_circ_g.3 AT2G35650_circ_g.4 AT2G35650_circ_g.5 AT2G35650_circ_g.6 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G35650.2:2 AT2G35650.3:2 AT2G35650.1:2 AT2G35650.4:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.292788231 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14987304-14987262(+) |
Potential amino acid sequence |
MDLAVRATLRGWKFLYIDDLKVKSELPCSFKALRSQQHRWTCGPANLLRKMAGQIIRSENVSLW KKWYMLYSFFFMRKIVAHILTFCFYCVILPATVLFPEVTVPKWAAFYLPSLITLLIAIGRLRSI HLLAFWVLFENAMSLLRAKALVMGLFETGRVQEWVVTEKLGDTLKTKLIPQVPNVRFRERNCWR LENLSIE* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |