Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA010799_circ_g.1 |
ID in PlantcircBase | osi_circ_004793 |
Alias | 3:13695270|13695965 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 13695270-13695965 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA010799 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA010799-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13695929-13695906(+) |
Potential amino acid sequence |
MTSMDLTLLSKATFLVTEASVRADFASKTPNLDASSSKPFTNLWLSSTVLFEASSSTFTCTSST LFVSSSPLNLSLRDVS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |