Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0295800_circ_g.2 |
| ID in PlantcircBase | osa_circ_027289 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13095538-13097140 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0295800 |
| Parent gene annotation |
Similar to Glyoxalase I (EC 4.4.1.5). (Os05t0295800-01);Nuclear- localized glyoxalase I (EC:4.4.1.5), Detoxification of methylgly oxal in the nucleus (Os05t0295800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0295800-02:3 Os05t0295800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104312232 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13097142-13097130(-) |
| Potential amino acid sequence |
MFRVKDPKVSLDFYSRVMGMSLLKRLDFPEMKFSLYFLGYEDVESAPTDPVKRTVWTFGQRATL ELTQCSV*(-) |
| Sponge-miRNAs | osa-miR2923 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |