Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G267500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000407 |
| Alias | Chr04:60266908|60267452 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 60266908-60267452 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G267500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.004G267500_circ_g.2 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.004G267500.2:2 Gorai.004G267500.3:2 Gorai.004G267500.1:2 Gorai.004G267500.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.126152355 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
60266909-60266936(+) 60267366-60267364(-) |
| Potential amino acid sequence |
MERQRREEELKNRSSKKGHEAEQGMLNRAPSPQPGGQQTGGTLKSLKEKFGQGEKEVQEGSALK VAGADKEITAGWKDSAGRRS*(+) MTSRFHQFADHLVEDLVPYSAFPAQLHVLSLRTDSSAPPPGAVFPSCSYFFISTSNFQSRPLLY FFLTLPKFLFQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |