Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0460800_circ_g.2 |
| ID in PlantcircBase | osa_circ_011450 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 16196570-16198327 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0460800 |
| Parent gene annotation |
LAMMER kinase-type protein, Positive regulator of disease resist ance (Os12t0460800-01);Similar to Lammer-type protein kinase. (O s12t0460800-02);Similar to Lammer-type protein kinase. (Os12t046 0800-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0460800_circ_g.3 Os12g0460800_circ_g.4 Os12g0460800_circ_g.5 Os12g0460800_circ_g.6 Os12g0460800_circ_g.7 Os12g0460800_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0460800-03:4 Os12t0460800-01:6 Os12t0460800-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.239754053 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16197247-16196570(+) 16196822-16198081(-) |
| Potential amino acid sequence |
MKPGSTFFIFTKLLEHANFYHCSIPVLLNASDDLNGHHFFPFPIPTFQYLTKGTFTHFCINPV* (+) MMERVFGPLPCHMLKRADRHSEKYVRKGRLNWPEGCASRDSMKAVMKLPRLQTGLMQKWVKVPL VRYWNVGIGKGKKWWPLRSSEALRSTGMLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |