Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0425300_circ_g.1 |
| ID in PlantcircBase | osa_circ_009228 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 13461252-13461311 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os11g0425300 |
| Parent gene annotation |
Similar to predicted protein. (Os11t0425300-01);Conserved hypoth etical protein. (Os11t0425300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0425300-02:1 Os11t0425300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.259717778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13461275-13461308(+) 13461257-13461254(-) |
| Potential amino acid sequence |
MPDVLFAYIPPRTHSRCCAVMPDVLFAYIPPRTHSRCCAVMPDVLFAYIPPRTHSRCCAVMPDV LFAYIPPR(+) MGSRWYICKQHIWHYSTTSRMGSRWYICKQHIWHYSTTSRMGSRWYICKQHIWHYSTTSRM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |