Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0857000_circ_g.5 |
| ID in PlantcircBase | osa_circ_004876 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 37027338-37028280 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0857000 |
| Parent gene annotation |
Double-stranded RNA-binding-like domain containing protein. (Os0 1t0857000-01);Similar to CPL2 (CTD phosphatase-like 2); double-s tranded RNA binding. (Os01t0857000-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0857000_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0857000-02:3 Os01t0857000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211498657 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37028231-37028228(-) |
| Potential amino acid sequence |
MSGAEVGKRLNGLAYPRDQKQISNLTGDHWQQPPHYLSRCCKKLDGCANPGTLILHQTIRMLPL YLRV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |