Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G79950_circ_g.2 |
ID in PlantcircBase | ath_circ_011166 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 30076734-30076832 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G79950 |
Parent gene annotation |
RAD3-like DNA-binding helicase protein |
Parent gene strand | + |
Alternative splicing | AT1G79950_circ_g.1 AT1G79950_circ_g.3 AT1G79950_circ_g.4 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G79950.5:1 AT1G79950.1:1 AT1G79950.6:1 AT1G79950.2:1 AT1G79950.7:1 AT1G79950.3:1 AT1G79950.4:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.186870791 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30076749-30076829(+) |
Potential amino acid sequence |
MTVWERICKLKKPVIEPKDSSLFPAAMRCYRNSMTVWERICKLKKPVIEPKDSSLFPAAMRCYR NSMTVWERICKLKKPVIEPKDSSLFPAAMRCYRNSMTVWERICKLKKPVIEPKDSSLFPAAMR( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |