Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0760300_circ_g.3 |
| ID in PlantcircBase | osa_circ_016650 |
| Alias | Os02circ27294 |
| Organism | Oryza sativa |
| Position | chr2: 32018374-32019344 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, SMALT, Segemehl |
| Parent gene | Os02g0760300 |
| Parent gene annotation |
Similar to Immunophilin. (Os02t0760300-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0760300_circ_g.4 Os02g0760300_circ_g.5 Os02g0760300_circ_g.6 Os02g0760300_circ_g.7 Os02g0760300_circ_g.8 |
| Support reads | 2/1 |
| Tissues | leaf/seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0760300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109598035 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32018403-32018408(+) 32018411-32019043(-) |
| Potential amino acid sequence |
MVITPSSHPLITEPWPILKLNGSWPASFVLQNFLARSLSFPEYEQLHPLAWS*(+) MTMQVGEVARIQGKIMISLRSFGAQRTQARSHSVSI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |