Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g018500.1_circ_g.3 |
ID in PlantcircBase | sly_circ_003330 |
Alias | 11:8624991|8625600 |
Organism | Solanum lycopersicum |
Position | chr11: 8624991-8625600 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc11g018500.1 |
Parent gene annotation |
Beta-galactosidase |
Parent gene strand | + |
Alternative splicing | Solyc11g018500.1_circ_g.1 Solyc11g018500.1_circ_g.2 |
Support reads | 4 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc11g018500.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.239549549 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8625272-8624992(+) 8625593-8624992(+) |
Potential amino acid sequence |
MAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEYMITSYYDQAPLDEYD*(+) MSTINACNGLRCGETFTGPNSPNKPSIWTENWTSFYQVYGQNATLRSAEDMAYHVALFIARKNG TFINYYMYHGGTNFGRTAAEYMITSYYDQAPLDEYD*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |