Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc11g018500.1_circ_g.3 |
| ID in PlantcircBase | sly_circ_003330 |
| Alias | 11:8624991|8625600 |
| Organism | Solanum lycopersicum |
| Position | chr11: 8624991-8625600 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc11g018500.1 |
| Parent gene annotation |
Beta-galactosidase |
| Parent gene strand | + |
| Alternative splicing | Solyc11g018500.1_circ_g.1 Solyc11g018500.1_circ_g.2 |
| Support reads | 4 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc11g018500.1.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.239549549 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8625272-8624992(+) 8625593-8624992(+) |
| Potential amino acid sequence |
MAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEYMITSYYDQAPLDEYD*(+) MSTINACNGLRCGETFTGPNSPNKPSIWTENWTSFYQVYGQNATLRSAEDMAYHVALFIARKNG TFINYYMYHGGTNFGRTAAEYMITSYYDQAPLDEYD*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |