Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0931200_circ_g.2 |
ID in PlantcircBase | osa_circ_005669 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 40863692-40863836 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0931200 |
Parent gene annotation |
Armadillo-type fold domain containing protein. (Os01t0931200-01) |
Parent gene strand | - |
Alternative splicing | Os01g0931200_circ_g.3 Os01g0931200_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0931200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.399949425 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40863766-40863765(+) 40863828-40863828(-) |
Potential amino acid sequence |
MMEVLHTALRGLFIVFTIASITLPQLVEGVVGGGGEEVAEGVEHVGARHDGGLAHRAARALHRL HDRQHHLATACRRRRRRRRRGGCRRSRTRRCTP*(+) MLAIVKTMKSPRSAVCKTSIMACTDVFDSFGNLLSSASDDAFDKLWQGDAGDREDDEEPAQRGV QDLHHGVHRRVRLLRQPPLLRLRRRLRQAVAR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |