Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G48410_circ_g.12 |
| ID in PlantcircBase | ath_circ_006304 |
| Alias | At_ciR1663, Ath_circ_FC0695, Ath_circ_FC4787, AT1G48410_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17890735-17890884 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT1G48410 |
| Parent gene annotation |
ICU9 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6/3 |
| Tissues | leaf/root, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G48410.1:1 AT1G48410.3:1 AT1G48410.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.75683805 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17890821-17890737(-) |
| Potential amino acid sequence |
MFLEGKQSDAPQEALQVLDIVLRELPTSRREREFKVVIKLVARADLHHLGMFLEGKQSDAPQEA LQVLDIVLRELPTSRREREFKVVIKLVARADLHHLGMFLEGKQSDAPQEALQVLDIVLRELPTS RREREFKVVIKLVARADLHHLGMFLEGKQSDAPQEALQVLDIVLRELPTS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |