Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0170100_circ_g.2 |
| ID in PlantcircBase | osa_circ_032925 |
| Alias | Os07circ03152/Os_ciR1012 |
| Organism | Oryza sativa |
| Position | chr7: 3720755-3721821 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ |
| Parent gene | Os07g0170100 |
| Parent gene annotation |
Similar to Branched chain alpha-keto acid dehydrogenase E1 beta subunit. (Os07t0170100-01);Similar to Branched chain alpha-keto acid dehydrogenase E1 beta subunit. (Os07t0170100-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0170100_circ_g.1 Os07g0170100_circ_g.3 |
| Support reads | 4/22/5/7 |
| Tissues | leaf and panicle/root/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0170100-02:5 Os07t0170100-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007047* osi_circ_017569 zma_circ_001267 |
| PMCS | 0.509616333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3721531-3721758(-) 3720833-3721758(-) |
| Potential amino acid sequence |
MGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIRSPYGAVGHGGHYHSQSPEA FFCHVPGLKLLCLRGRCGFRWCLPLHNRAR*(-) MALSVMVVTTIHSHQRLSFVMFLDSSSYVFGEDVGFGGVFRCTTGLADRFGRNRVFNTPLCEQG IAGFAVGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIRSPYGAVGHG GHYHSQSPEAFFCHVPGLKLLCLRGRCGFRWCLPLHNRAR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |