Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G095800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000254 |
| Alias | Chr03:29865105|29865351 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 29865105-29865351 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G095800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.003G095800_circ_g.2 |
| Support reads | 6 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G095800.2:1 Gorai.003G095800.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.982009649 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29865246-29865225(-) 29865140-29865225(-) |
| Potential amino acid sequence |
MNPQQTINIWYVPRKKDSFSKPDDILTAAEKYIEENGTDAFEKLIHRDSYLVLCKADFHLLAGH PVLLWRCLCLRALSATLLYEPTTDD*(-) MEQMHLRSSFIGIPIWSYAKLIFTCWLVIPYFSGAAYVYEHYLRPFFMNPQQTINIWYVPRKKD SFSKPDDILTAAEKYIEENGTDAFEKLIHRDSYLVLCKADFHLLAGHPVLLWRCLCLRALSATL LYEPTTDD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |