Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G27370_circ_g.1 |
| ID in PlantcircBase | ath_circ_004507 |
| Alias | AT1G27370_C1, AT1G27370_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 9505718-9506203 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G27370 |
| Parent gene annotation |
Squamosa promoter-binding-like protein 10 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G27370.5:2 AT1G27370.3:2 AT1G27370.6:2 AT1G27370.2:2 AT1G27370.1:2 AT1G27370.4:2 AT1G27370.7:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.46236262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9505948-9506102(-) 9505827-9506182(-) |
| Potential amino acid sequence |
MLWNGLSLNTRSEEKYTWGTTYETKPTQMESGFTLSFQRGNGSEDQLFTGSTLSFSAFQTSGGF SAGKSNIQLPDKGSMLSQNLMKRNEAAANVFLIIMQGVASHKEYFH* MALRTNCLLVAPSLSLRFKHLVGSQQGNPTFNFQTKVPCCLRI* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |