Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G27370_circ_g.1 |
ID in PlantcircBase | ath_circ_004507 |
Alias | AT1G27370_C1, AT1G27370_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 9505718-9506203 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G27370 |
Parent gene annotation |
Squamosa promoter-binding-like protein 10 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G27370.5:2 AT1G27370.3:2 AT1G27370.6:2 AT1G27370.2:2 AT1G27370.1:2 AT1G27370.4:2 AT1G27370.7:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.46236262 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9505948-9506102(-) 9505827-9506182(-) |
Potential amino acid sequence |
MLWNGLSLNTRSEEKYTWGTTYETKPTQMESGFTLSFQRGNGSEDQLFTGSTLSFSAFQTSGGF SAGKSNIQLPDKGSMLSQNLMKRNEAAANVFLIIMQGVASHKEYFH* MALRTNCLLVAPSLSLRFKHLVGSQQGNPTFNFQTKVPCCLRI* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |