Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0472000_circ_g.2 |
| ID in PlantcircBase | osa_circ_009326 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 16253464-16255161 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0472000 |
| Parent gene annotation |
Zinc finger, CCCH-type domain containing protein. (Os11t0472000- 01);Hypothetical conserved gene. (Os11t0472000-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0472000_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0472000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109417422 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16254444-16255146(-) 16255158-16255146(-) |
| Potential amino acid sequence |
MSILFEDWNMQIWSNMQVSPPPRKSCNCNPSTAECFRLPIAAEAMWQMNLGEAMEAGPYPERIG EPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATC KFHHPREKAAIATRVQLNALGYPLRPRQCGR*(-) MWQMNLGEAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKGEYPQRI GQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPRQCGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |