Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0218700_circ_g.1 |
| ID in PlantcircBase | osa_circ_000854 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 6502915-6503156 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0218700 |
| Parent gene annotation |
ABC transporter integral membrane type 1 domain containing prote in. (Os01t0218700-01);Similar to peroxisomal membrane ABC transp orter family, PMP family. (Os01t0218700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0218700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.19455699 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6502965-6502934(+) 6503018-6503084(-) |
| Potential amino acid sequence |
MFPLLGVNNVKLQISRTMDGLDCVGDPLELSTVGPVLLKIMLIPSMLSGLDKDEPFPSNRSSNS PVGGPFL*(+) MVLEICNLTLLTPRSGNILITDLTMELKEKDHLLVNLMICWMEMVHLYPSLITLMGST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |