Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0646600_circ_g.2 |
ID in PlantcircBase | osa_circ_031761 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 26412126-26412743 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os06g0646600 |
Parent gene annotation |
Similar to Homeobox protein knotted-1-like 11. (Os06t0646600-01) ;Similar to cDNA, clone: J065162G03, full insert sequence. (Os06 t0646600-02) |
Parent gene strand | - |
Alternative splicing | Os06g0646600_circ_g.1 |
Support reads | 32 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0646600-02:3 Os06t0646600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.391964253 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26412739-26412368(+) 26412713-26412730(-) |
Potential amino acid sequence |
MPLFLLLLSDEDEAGLLCQFRLRWLINQLLICFSCNPVSCTKRALSSSVGYGHLE*(+) MSDDEDNQVDSESNMFDGNDGSDGMGFGPLMLTEGERSLVERVRQELKHELKQGYREKLVDIRE EILRKRRAGKLPGDTASTLKAWWQAHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH SNPASSSSDKSKRKRGISS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |