Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0646600_circ_g.2 |
| ID in PlantcircBase | osa_circ_031761 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 26412126-26412743 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0646600 |
| Parent gene annotation |
Similar to Homeobox protein knotted-1-like 11. (Os06t0646600-01) ;Similar to cDNA, clone: J065162G03, full insert sequence. (Os06 t0646600-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0646600_circ_g.1 |
| Support reads | 32 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0646600-02:3 Os06t0646600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.391964253 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26412739-26412368(+) 26412713-26412730(-) |
| Potential amino acid sequence |
MPLFLLLLSDEDEAGLLCQFRLRWLINQLLICFSCNPVSCTKRALSSSVGYGHLE*(+) MSDDEDNQVDSESNMFDGNDGSDGMGFGPLMLTEGERSLVERVRQELKHELKQGYREKLVDIRE EILRKRRAGKLPGDTASTLKAWWQAHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH SNPASSSSDKSKRKRGISS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |