Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0657500_circ_g.1 |
ID in PlantcircBase | osa_circ_031828 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 27026442-27026890 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0657500 |
Parent gene annotation |
Hypothetical conserved gene. (Os06t0657500-01);Similar to ANT (O vule development protein aintegumenta). (Os06t0657500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0657500-02:3 Os06t0657500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016502 |
PMCS | 0.155552079 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27026545-27026854(-) 27026552-27026610(-) |
Potential amino acid sequence |
MTCMHKPWRPLRLWPSRRQLLSHRCASYLPVHRCREVRRGGWTPVL*(-) MGYDMHAQTLAAFAALAFPAAAIVPQVRLVPPRPPVQGSSSWWLDPSTLGRRGRKLLRPSPPYH NLLSRLMEYHHRRSANRREIRLEKSRYKC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |