Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0657500_circ_g.1 |
| ID in PlantcircBase | osa_circ_031828 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 27026442-27026890 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0657500 |
| Parent gene annotation |
Hypothetical conserved gene. (Os06t0657500-01);Similar to ANT (O vule development protein aintegumenta). (Os06t0657500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0657500-02:3 Os06t0657500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016502 |
| PMCS | 0.155552079 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27026545-27026854(-) 27026552-27026610(-) |
| Potential amino acid sequence |
MTCMHKPWRPLRLWPSRRQLLSHRCASYLPVHRCREVRRGGWTPVL*(-) MGYDMHAQTLAAFAALAFPAAAIVPQVRLVPPRPPVQGSSSWWLDPSTLGRRGRKLLRPSPPYH NLLSRLMEYHHRRSANRREIRLEKSRYKC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |