Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0127000_circ_g.2 |
| ID in PlantcircBase | osa_circ_029478 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1425826-1426739 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0127000 |
| Parent gene annotation |
Peroxisomal biogenesis factor 11 family protein. (Os06t0127000-0 1);Peroxisomal biogenesis factor 11 family protein. (Os06t012700 0-02);Peroxisomal biogenesis factor 11 family protein. (Os06t012 7000-03);Peroxisomal protein, Response to abscisic acid (ABA), h ydrogen peroxide, and salt (Os06t0127000-04) |
| Parent gene strand | + |
| Alternative splicing | Os06g0127000_circ_g.3 Os06g0127000_circ_g.4 Os06g0127000_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0127000-04:5 Os06t0127000-01:5 Os06t0127000-03:5 Os06t0127000-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2176312 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1425843-1425903(+) |
| Potential amino acid sequence |
MSSLESARADLALLILYLNKAEARDKICRAIQYGSKFVSNGQPGPAQNVDKSTSLARKVFRLFK FVNDLHALISPPAKGTPLPLILLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAEFLSKIAFY CFLGSNTCTSIIEVAELQRLSKSMKKLEKELKHQELLKSPAIQYEFTGECKSRSCSAYFIPKQG *(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |