Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0127000_circ_g.2 |
ID in PlantcircBase | osa_circ_029478 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 1425826-1426739 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0127000 |
Parent gene annotation |
Peroxisomal biogenesis factor 11 family protein. (Os06t0127000-0 1);Peroxisomal biogenesis factor 11 family protein. (Os06t012700 0-02);Peroxisomal biogenesis factor 11 family protein. (Os06t012 7000-03);Peroxisomal protein, Response to abscisic acid (ABA), h ydrogen peroxide, and salt (Os06t0127000-04) |
Parent gene strand | + |
Alternative splicing | Os06g0127000_circ_g.3 Os06g0127000_circ_g.4 Os06g0127000_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0127000-04:5 Os06t0127000-01:5 Os06t0127000-03:5 Os06t0127000-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.2176312 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1425843-1425903(+) |
Potential amino acid sequence |
MSSLESARADLALLILYLNKAEARDKICRAIQYGSKFVSNGQPGPAQNVDKSTSLARKVFRLFK FVNDLHALISPPAKGTPLPLILLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAEFLSKIAFY CFLGSNTCTSIIEVAELQRLSKSMKKLEKELKHQELLKSPAIQYEFTGECKSRSCSAYFIPKQG *(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |