Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0822700_circ_g.1 |
| ID in PlantcircBase | osa_circ_022500 |
| Alias | Os_ciR8973 |
| Organism | Oryza sativa |
| Position | chr3: 34537014-34537729 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0822700 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os03t0822700- 01);Similar to Armadillo/beta-catenin-like repeat family protein . (Os03t0822700-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0822700_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0822700-02:2 Os03t0822700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.121508159 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34537037-34537078(+) |
| Potential amino acid sequence |
MEAMQANTMDVVKRMKEITQVMKTPDDVLQSQGVTPENIEDMLDELQEHVESIDMANVRRTRNG LWRQCKLIQWMLLRG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |