Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G02090_circ_g.7 |
| ID in PlantcircBase | ath_circ_019238 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 368003-368068 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G02090 |
| Parent gene annotation |
Insulinase (Peptidase family M16) protein |
| Parent gene strand | + |
| Alternative splicing | AT3G02090_circ_g.5 AT3G02090_circ_g.6 AT3G02090_circ_g.8 AT3G02090_circ_g.9 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G02090.1:1 AT3G02090.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.352271086 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
368027-368065(+) 368016-368005(-) |
| Potential amino acid sequence |
MDGTSPIAEDIGRQLKSSLLLHMDGTSPIAEDIGRQLKSSLLLHMDGTSPIAEDIGRQLKSSLL LHMDGTSPIAEDIGRQ(+) MMISADDQYLQQLGWFHPCEVTMMISADDQYLQQLGWFHPCEVTMMISADDQYLQQLGWFHPCE VTMMIS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |